Proteintech, 13025-1-AP, L-Plastin Polyclonal antibody

Size: 20ul / 150ul The L-Plastin (13025-1-AP) by Proteintech is a Polyclonal antibody targeting L-Plastin in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13025-1-AP targets L-Plastin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, mouse spleen tissue, RAW 264.7 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information LCP1, also known as L-Plastin, is a member of the Plastin gene family. The family members include L-Plastin (LCP1), T-Plastin (PLS3), and I-Plastin (PLS1), which can regulate the dynamic reorganization of the cytoskeleton by binding and cross-linking actin filaments. In lymphocytes, LCP1 can regulate immune responses, especially during inflammation and infection. It acts as a key regulator of T-cell activation by responding to co-stimulatory signals through TCR/CD3 and CD2 or CD28, and regulates the cell-surface expression of IL2RA/CD25 and CD69 (PMID: 17294403). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey, zebrafish, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3571 Product name: Recombinant human LCP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-627 aa of BC010271 Sequence: LENAGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAEKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV Predict reactive species Full Name: lymphocyte cytosolic protein 1 (L-plastin) Calculated Molecular Weight: 627 aa, 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC010271 Gene Symbol: L-Plastin Gene ID (NCBI): 3936 RRID: AB_2136871 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.