Iright
BRAND / VENDOR: Proteintech

Proteintech, 13031-1-AP, AADAT Polyclonal antibody

CATALOG NUMBER: 13031-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AADAT (13031-1-AP) by Proteintech is a Polyclonal antibody targeting AADAT in IHC, ELISA applications with reactivity to human, mouse, rat samples 13031-1-AP targets AADAT in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse cerebellum tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AADAT (alpha-aminoadipate aminotransferase), also known as KAT (kynurenine aminotransferase) II, is a primary enzyme in the brain for catalysing the transamination of kynurenine to KYNA (kynurenic acid). KYNA is the only known endogenous antagonist of the N-methyl-D-aspartate receptor. AADAT is also involved in lysine metabolism by catalyzing the transamination of aminoadipate to a-ketoadipate (PMID: 17024659, 18056995). The human AADAT enzyme is also predicted to contain a mitochondrial cleavage signal, suggesting that AADAT is a mitochondrial protein (PMID: 19826765). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3676 Product name: Recombinant human AADAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-429 aa of BC031068 Sequence: SAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL Predict reactive species Full Name: aminoadipate aminotransferase Calculated Molecular Weight: 429 aa, 48 kDa GenBank Accession Number: BC031068 Gene Symbol: AADAT Gene ID (NCBI): 51166 RRID: AB_2877904 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5Z0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924