Proteintech, 13040-1-AP, GRID1 Polyclonal antibody

Size: 20ul / 150ul The GRID1 (13040-1-AP) by Proteintech is a Polyclonal antibody targeting GRID1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13040-1-AP targets GRID1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissue, human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GRID1 (Glutamate Ionotropic Receptor Delta Type Subunit 1) is a protein-coding gene that belongs to the family of ionotropic glutamate receptors. These receptors are crucial for rapid excitatory synaptic transmission and synaptic plasticity in the central nervous system. GRID1 is primarily expressed in various brain regions, including the cortex, hippocampus, amygdala, striatum, thalamus, nucleus accumbens, lateral hooked nucleus, and dorsal raphe nucleus. In the hippocampus, GRID1 is specifically expressed in the granule cells of the dentate gyrus. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3694 Product name: Recombinant human GRID1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-348 aa of BC039263 Sequence: IHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMAS Predict reactive species Full Name: glutamate receptor, ionotropic, delta 1 Calculated Molecular Weight: 1009 aa, 112 kDa Observed Molecular Weight: 100-112 kDa GenBank Accession Number: BC039263 Gene Symbol: GRID1 Gene ID (NCBI): 2894 RRID: AB_10638439 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.