Iright
BRAND / VENDOR: Proteintech

Proteintech, 13058-1-AP, MACF1 Polyclonal antibody

CATALOG NUMBER: 13058-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MACF1 (13058-1-AP) by Proteintech is a Polyclonal antibody targeting MACF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13058-1-AP targets MACF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U-87 MG cells, NIH/3T3 cells, mouse lung tissue Positive IHC detected in: human lung tissue, human skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MACF1, also called ACF7 (actin crosslinking family 7), is a member of the spectraplakin family and is a ubiquitously expressed 614 kDa protein. This protein facilitates actin-microtubule interactions at the cell periphery and couples the microtubule network to cellular junctions. It displays a conserved role in membrane protrusion formation during evolution. The two major MACF1 isoforms characterized to date, MACF1a and MACF1b, result from alternative splicing. Both proteins contain N-terminal actin-binding domains (ABD), followed by plakin domains, extended spectrin repeat domains, EF-hand motifs, and C-terminal microtubule-binding domains (MTBDs). MACF1 is expressed in numerous tissue, including the skin, brain, skeletal muscle, and heart. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3730 Product name: Recombinant human MACF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-305 aa of BC007330 Sequence: EDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKTSLQFSRCYDKPWLVNSKAGTPIRDSHSPDLQLPTPEVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR Predict reactive species Full Name: microtubule-actin crosslinking factor 1 Calculated Molecular Weight: 5430 aa, 620 kDa Observed Molecular Weight: 600 kDa GenBank Accession Number: BC007330 Gene Symbol: MACF1 Gene ID (NCBI): 23499 RRID: AB_2877907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924