Proteintech, 13060-2-AP, CDK2AP1 Polyclonal antibody

Size: 20ul / 150ul The CDK2AP1 (13060-2-AP) by Proteintech is a Polyclonal antibody targeting CDK2AP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13060-2-AP targets CDK2AP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human placenta tissue, human brain tissue, human heart tissue, human liver tissue, human ovary tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3736 Product name: Recombinant human CDK2AP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC034717 Sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS Predict reactive species Full Name: cyclin-dependent kinase 2 associated protein 1 Calculated Molecular Weight: 115 aa, 13 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC034717 Gene Symbol: CDK2AP1 Gene ID (NCBI): 8099 RRID: AB_10340136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.