Iright
BRAND / VENDOR: Proteintech

Proteintech, 13069-1-AP, NKX3-1 Polyclonal antibody

CATALOG NUMBER: 13069-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NKX3-1 (13069-1-AP) by Proteintech is a Polyclonal antibody targeting NKX3-1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13069-1-AP targets NKX3-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, human testis tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information NKX3-1, also named as NKX3.1 and NKX3A, belongs to the NK-3 homeobox family. It is a transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. NKX3-1 plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. It act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells(PMID:19462257). The calcualted molecular weight of NKX3-1 is 26 kDa, but modified NKX3-1 is about 32-35 kDa. (PMID: 18597829) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4070 Product name: Recombinant human NKX3-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC074864 Sequence: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW Predict reactive species Full Name: NK3 homeobox 1 Calculated Molecular Weight: 234 aa, 26 kDa Observed Molecular Weight: 34-38 kDa GenBank Accession Number: BC074864 Gene Symbol: NKX3-1 Gene ID (NCBI): 4824 RRID: AB_10640580 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99801 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924