Iright
BRAND / VENDOR: Proteintech

Proteintech, 13073-1-AP, ALOX15B Polyclonal antibody

CATALOG NUMBER: 13073-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALOX15B (13073-1-AP) by Proteintech is a Polyclonal antibody targeting ALOX15B in WB, ELISA applications with reactivity to human samples 13073-1-AP targets ALOX15B in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HL-60 cells, HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information In humans, there are 6 functional lipoxygenases genes. Two of them encode for arachidonic acid 12-lipoxygenating (ALOX12, ALOX12B) and two for 15-lipoxygenating enzymes (ALOX15, ALOX15B). ALOX15B has been described as the most abundant 15-lipoxygenating enzyme species in human carotid atherosclerotic lesions and to be associated with cerebrovascular symptoms. (PMID:24373925). ALOX15B has 4 isoforms produced by alternative splicing with the MW of 76, 67, 69 and 73 kDa. 13073-1-AP can also recognize the mouse Alox8 protein. Specification Tested Reactivity: human Cited Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3741 Product name: Recombinant human ALOX15B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC035217 Sequence: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKW Predict reactive species Full Name: arachidonate 15-lipoxygenase, type B Calculated Molecular Weight: 676 aa, 76 kDa Observed Molecular Weight: 67-76 kDa GenBank Accession Number: BC035217 Gene Symbol: ALOX15B Gene ID (NCBI): 247 RRID: AB_2227031 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924