Product Description
Size: 20ul / 150ul
The CCK (13074-2-AP) by Proteintech is a Polyclonal antibody targeting CCK in IHC, ELISA applications with reactivity to human, mouse samples
13074-2-AP targets CCK in IHC, IF, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: human pancreas tissue, human stomach tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Cholecystokinin (CCK) is a classic gut hormone. CCK is also a complex system of peptides expressed in several molecular forms in enteroendocrine I cells, in cerebral and peripheral neurons, in cardiac myocytes and spermatozoa. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag3725 Product name: Recombinant human CCK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC008283 Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS Predict reactive species
Full Name: cholecystokinin
Calculated Molecular Weight: 115 aa, 13 kDa
GenBank Accession Number: BC008283
Gene Symbol: CCK
Gene ID (NCBI): 885
RRID: AB_2228728
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P06307
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924