Iright
BRAND / VENDOR: Proteintech

Proteintech, 13080-1-AP, SLC25A32 Polyclonal antibody

CATALOG NUMBER: 13080-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A32 (13080-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A32 in WB, IHC, ELISA applications with reactivity to human samples 13080-1-AP targets SLC25A32 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Solute carrier family 25 member 32 (SLC25A32) can transfer tetrahydrofolate (THF) from cellular cytoplasm to the mitochondria as a mitochondrial folate transporter (MFT). It has been reported that SLC25A32 can also transport FAD across the mitochondrial inner membrane. Chronic alcohol exposure affects mitochondrial folate uptake and may affect the transcription of the SLC25A32. And functional SLC25A32 defect is associated with the cranial neural tube defects(PMID: 21956163; 29666258) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3722 Product name: Recombinant human SLC25A32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-315 aa of BC021893 Sequence: MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLTTIWKLDGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCITFVVYENVSHFLLDLREKRK Predict reactive species Full Name: solute carrier family 25, member 32 Calculated Molecular Weight: 315 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC021893 Gene Symbol: SLC25A32 Gene ID (NCBI): 81034 RRID: AB_2877913 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2D1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924