Iright
BRAND / VENDOR: Proteintech

Proteintech, 13086-1-AP, FREM1 Polyclonal antibody

CATALOG NUMBER: 13086-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FREM1 (13086-1-AP) by Proteintech is a Polyclonal antibody targeting FREM1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13086-1-AP targets FREM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, HepG2 cells Positive IHC detected in: human hepatocellular cancer, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FREM1, C9orf143, C9orf145, C9orf154 and QBRICK, is an extracellular matrix protein that plays a role in epidermal differentiation and is required for epidermal adhesion during embryonic development. This antibody recognizes isoform 1 (244 kDa), isform 2 (80 kDa) and isoform 3 (43 kDa). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3617 Product name: Recombinant human FREM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 412-710 aa of BC031064 Sequence: SSSTTSGSFHLERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVYRNGTDIIYNYHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTIKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSPRSKLGKSCVLVQRQGKWQTKDCRRAKPHNYGCSRKL Predict reactive species Full Name: FRAS1 related extracellular matrix 1 Calculated Molecular Weight: 2179aa, 244 kDa, 149.3 kDa Observed Molecular Weight: 40-43 kDa, 70-80 kDa GenBank Accession Number: BC031064 Gene Symbol: FREM1 Gene ID (NCBI): 158326 RRID: AB_2877915 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5H8C1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924