Proteintech, 13098-1-AP, Fas/CD95 Polyclonal antibody

Size: 20ul / 150ul The Fas/CD95 (13098-1-AP) by Proteintech is a Polyclonal antibody targeting Fas/CD95 in WB, IP, ELISA applications with reactivity to human samples 13098-1-AP targets Fas/CD95 in WB, IHC, IF, IP, CoIP, CHIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, HT-29 cells, Jurkat cells, HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation. Specification Tested Reactivity: human Cited Reactivity: human, monkey, hamster, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3718 Product name: Recombinant human FAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-335 aa of BC012479 Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Predict reactive species Full Name: Fas (TNF receptor superfamily, member 6) Calculated Molecular Weight: 35-38 kDa Observed Molecular Weight: 38-45 kDa GenBank Accession Number: BC012479 Gene Symbol: Fas/CD95 Gene ID (NCBI): 355 RRID: AB_2278042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25445 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.