Proteintech, 13101-1-AP, DNAJC10 Polyclonal antibody

Size: 20ul / 150ul The DNAJC10 (13101-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC10 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13101-1-AP targets DNAJC10 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissue, human stomach tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DNAJC10(DnaJ homolog subfamily C member 10)is also named as ERDJ5. The human ER-resident protein (ERdj5) ubiquitously expresses and is abundant in secretory tissues such as pancreas and testis and it may be involved in assisting protein folding and quality control in the ER(PMID:12411443). The deduced 793-amino acid protein has a calculated molecular mass of about 91 kD. ERDJ5 contains an N-terminal hydrophobic sequence, followed by a type III DnaJ domain, 4 thioredoxin-like domains, and a C-terminal KDEL endoplasmic reticulum (ER) retention signal. It can be modified by N-linked glycosylation(PMID:12446677). The ERdj5 antibody displays a higher affinity for endogenous ERdj5u. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3737 Product name: Recombinant human DNAJC10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 690-793 aa of BC034713 Sequence: HWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 10 Calculated Molecular Weight: 793 aa, 91 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC034713 Gene Symbol: DNAJC10 Gene ID (NCBI): 54431 RRID: AB_10638440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.