Proteintech, 13112-1-AP, PHPT1 Polyclonal antibody

Size: 20ul / 150ul The PHPT1 (13112-1-AP) by Proteintech is a Polyclonal antibody targeting PHPT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13112-1-AP targets PHPT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, human kidney tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3778 Product name: Recombinant human PHPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC024648 Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY Predict reactive species Full Name: phosphohistidine phosphatase 1 Calculated Molecular Weight: 125 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC024648 Gene Symbol: PHPT1 Gene ID (NCBI): 29085 RRID: AB_2163737 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.