Proteintech, 13145-1-AP, GLRA3 Polyclonal antibody

Size: 20ul / 150ul The GLRA3 (13145-1-AP) by Proteintech is a Polyclonal antibody targeting GLRA3 in WB, ELISA applications with reactivity to human, mouse, rat samples 13145-1-AP targets GLRA3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3702 Product name: Recombinant human GLRA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-255 aa of BC036086 Sequence: KETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGY Predict reactive species Full Name: glycine receptor, alpha 3 Calculated Molecular Weight: 464 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC036086 Gene Symbol: GLRA3 Gene ID (NCBI): 8001 RRID: AB_10638905 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.