Iright
BRAND / VENDOR: Proteintech

Proteintech, 13150-1-AP, GYG2 Polyclonal antibody

CATALOG NUMBER: 13150-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GYG2 (13150-1-AP) by Proteintech is a Polyclonal antibody targeting GYG2 in WB, IHC, ELISA applications with reactivity to human samples 13150-1-AP targets GYG2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, HEK-293 cells, human liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GYG2 belongs to the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation phase of glycogen biosynthesis. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, including the predominant band around 66 kDa and a light band around 45 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3765 Product name: Recombinant human GYG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-471 aa of BC023152 Sequence: FQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ Predict reactive species Full Name: glycogenin 2 Calculated Molecular Weight: 501 aa, 55 kDa Observed Molecular Weight: 45 kDa, 66-70 kDa GenBank Accession Number: BC023152 Gene Symbol: GYG2 Gene ID (NCBI): 8908 RRID: AB_2116111 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924