Proteintech, 13152-1-AP, GDAP1 Polyclonal antibody

Size: 20ul / 150ul The GDAP1 (13152-1-AP) by Proteintech is a Polyclonal antibody targeting GDAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13152-1-AP targets GDAP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, human brain tissue, fetal human brain tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information GDAP1 is a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3769 Product name: Recombinant human GDAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC024939 Sequence: MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLV Predict reactive species Full Name: ganglioside-induced differentiation-associated protein 1 Calculated Molecular Weight: 358 aa, 41 kDa Observed Molecular Weight: 36-41 kDa GenBank Accession Number: BC024939 Gene Symbol: GDAP1 Gene ID (NCBI): 54332 RRID: AB_2232103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TB36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.