Proteintech, 13160-1-AP, MYOZ1 Polyclonal antibody

Size: 20ul / 150ul The MYOZ1 (13160-1-AP) by Proteintech is a Polyclonal antibody targeting MYOZ1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13160-1-AP targets MYOZ1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human heart tissue Positive IP detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Myozenin-1 is a protein that in humans is encoded by the MYOZ1 gene. MYOZ1 has been shown to interact with Telethonin, and Actinin, alpha. The MW of this protein is 32 kDa, and Catalog#13160-1-AP specially recognises the 32 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat, fish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3806 Product name: Recombinant human MYOZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC025753 Sequence: MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL Predict reactive species Full Name: myozenin 1 Calculated Molecular Weight: 299 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC025753 Gene Symbol: MYOZ1 Gene ID (NCBI): 58529 RRID: AB_2282208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.