Proteintech, 13162-1-AP, RASGRP3 Polyclonal antibody

Size: 20ul / 150ul The RASGRP3 (13162-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP3 in WB, IP, ELISA applications with reactivity to human, mouse samples 13162-1-AP targets RASGRP3 in WB, IP, FC, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, PC-3 cells, Raji cells, Ramos cells Positive IP detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information AS guanyl releasing protein 3 (RasGRP3) is a member of the RasGRP family and is able to promote guanine nucleotide exchange of Ha-Ras, R-Ras and Rap1 (PMID: 9582122). RasGRP3 is involved in a diverse range of important biological processes. RasGRP3 has emerged as an important mediator of signaling downstream from receptor coupled phosphoinositide turnover in B and T cells. Overexpression of RasGRP3 is commonly associated with many malignancies, such as pre-Bcell leukemia, Burkitt's lymphoma and natural killer-like T-cell leukemia. Recently, it has been reported that upregulation of RASGRP3 expression in prostate cancer correlates with aggressive capabilities and predicts biochemical recurrence after radical prostatectomy (PMID: 24418912). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3810 Product name: Recombinant human RASGRP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 342-690 aa of BC027849 Sequence: SLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG Predict reactive species Full Name: RAS guanyl releasing protein 3 (calcium and DAG-regulated) Calculated Molecular Weight: 690 aa, 78 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC027849 Gene Symbol: RASGRP3 Gene ID (NCBI): 25780 RRID: AB_10640522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IV61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.