Iright
BRAND / VENDOR: Proteintech

Proteintech, 13170-1-AP, CIDEA Polyclonal antibody

CATALOG NUMBER: 13170-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CIDEA (13170-1-AP) by Proteintech is a Polyclonal antibody targeting CIDEA in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13170-1-AP targets CIDEA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Cell death-inducing DNA fragmentation factor (DFFA)-like effector (CIDE) family proteins, including Cidea, Cideb, and Fsp27 (Cidec), are lipid droplet (LD)-associated proteins playing important roles in LD fusion, lipid secretion, and very-low-density-lipoprotein (VLDL) maturation. Cidea is highly enriched in adult brown adipose tissue (BAT), and its deficiency results in the accumulation of smaller LDs in brown adipocytes, improved INS sensitivity, and resistance to diet-induced obesity. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3824 Product name: Recombinant human CIDEA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC031896 Sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG Predict reactive species Full Name: cell death-inducing DFFA-like effector a Calculated Molecular Weight: 253 aa, 28 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC031896 Gene Symbol: CIDEA Gene ID (NCBI): 1149 RRID: AB_10642957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924