Proteintech, 13176-1-AP, RALBP1 Polyclonal antibody

Size: 20ul / 150ul The RALBP1 (13176-1-AP) by Proteintech is a Polyclonal antibody targeting RALBP1 in WB, IHC, IP, ELISA applications with reactivity to human samples 13176-1-AP targets RALBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, HepG2 cells, MCF-7 cells Positive IP detected in: K-562 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3843 Product name: Recombinant human RALBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC013126 Sequence: MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQ Predict reactive species Full Name: ralA binding protein 1 Calculated Molecular Weight: 655 aa, 76 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC013126 Gene Symbol: RALBP1 Gene ID (NCBI): 10928 RRID: AB_2176171 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.