Proteintech, 13177-1-AP, APBB2 Polyclonal antibody

Size: 20ul / 150ul The APBB2 (13177-1-AP) by Proteintech is a Polyclonal antibody targeting APBB2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13177-1-AP targets APBB2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3844 Product name: Recombinant human APBB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 386-736 aa of BC027946 Sequence: SCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP Predict reactive species Full Name: amyloid beta (A4) precursor protein-binding, family B, member 2 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 83-95 kDa GenBank Accession Number: BC027946 Gene Symbol: APBB2 Gene ID (NCBI): 323 RRID: AB_10638434 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92870 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.