Iright
BRAND / VENDOR: Proteintech

Proteintech, 13184-1-AP, CDSN Polyclonal antibody

CATALOG NUMBER: 13184-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDSN (13184-1-AP) by Proteintech is a Polyclonal antibody targeting CDSN in WB, IHC, ELISA applications with reactivity to human, mouse samples 13184-1-AP targets CDSN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, NIH/3T3 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CDSN, also named as S protein, is important for the epidermal barrier integrity. CDSN is a unique extracellular 52- to 56-kDa glycoprotein found in corneodesmosomes. Pathogenic mutations in CDSN have been linked in humans to genodermatoses affecting both the hair follicle and the epidermis. Inflammatory peeling skin syndrome is caused a novel mutation in CDSN. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3854 Product name: Recombinant human CDSN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-503 aa of BC031993 Sequence: NSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISGSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILA Predict reactive species Full Name: corneodesmosin Calculated Molecular Weight: 528 aa, 52 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC031993 Gene Symbol: CDSN Gene ID (NCBI): 1041 RRID: AB_11183052 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15517 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924