Proteintech, 13193-1-AP, PPM1B Polyclonal antibody

Size: 20ul / 150ul The PPM1B (13193-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13193-1-AP targets PPM1B in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IHC detected in: human breast cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PPM1B is a member of the metal-dependent serine/threonine protein phosphatase (PPM) family with important regulatory functions in cellular signalling pathways(PMID: 18066953). PPM1B is also an important negative regulator of several stress signalling pathways and has been shown to negatively regulate the stress-activated p38 and JNK pathways by directly dephosphorylating upstream signalling proteins(PMID: 9824284). Moreover, PPM1B has also been shown to prevent cell death by negatively regulating necrotic cell death in a RIP3 dephosphorylation-dependent manner.(PMID: 25751141) PPM1B can be detected as the WM of 36-55 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3871 Product name: Recombinant human PPM1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC012002 Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI Predict reactive species Full Name: protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform Calculated Molecular Weight: 479 aa, 53 kDa Observed Molecular Weight: 36, 53 kDa GenBank Accession Number: BC012002 Gene Symbol: PPM1B Gene ID (NCBI): 5495 RRID: AB_10644118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75688 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.