Proteintech, 13217-1-AP, PNMT Polyclonal antibody

Size: 20ul / 150ul The PNMT (13217-1-AP) by Proteintech is a Polyclonal antibody targeting PNMT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13217-1-AP targets PNMT in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells Positive IP detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Phenylethanolamine N-methyltransferase(PNMT), the final enzyme in catecholamine biosynthesis, converts norepinephrine to epinephrine, thereby serving as a marker of the adrenergic phenotype. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4098 Product name: Recombinant human PNMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC037246 Sequence: MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL Predict reactive species Full Name: phenylethanolamine N-methyltransferase Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC037246 Gene Symbol: PNMT Gene ID (NCBI): 5409 RRID: AB_2167781 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.