Proteintech, 13225-1-AP, RCBTB2 Polyclonal antibody

Size: 20ul / 150ul The RCBTB2 (13225-1-AP) by Proteintech is a Polyclonal antibody targeting RCBTB2 in WB, ELISA applications with reactivity to human, mouse, rat samples 13225-1-AP targets RCBTB2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3975 Product name: Recombinant human RCBTB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-551 aa of BC029052 Sequence: TIACGQMCCMAVVDTGEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFRSSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN Predict reactive species Full Name: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 Calculated Molecular Weight: 551 aa, 60 kDa Observed Molecular Weight: 58-60 kDa GenBank Accession Number: BC029052 Gene Symbol: RCBTB2 Gene ID (NCBI): 1102 RRID: AB_2179570 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95199 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.