Proteintech, 13230-1-AP, SIGLEC5 Polyclonal antibody

Size: 20ul / 150ul The SIGLEC5 (13230-1-AP) by Proteintech is a Polyclonal antibody targeting SIGLEC5 in WB, ELISA applications with reactivity to human samples 13230-1-AP targets SIGLEC5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Sialic acid binding Ig-like lectin 5 (Siglec-5), also known as CD170, is a member of the CD33-related Siglec subfamily. Siglec-5 is a type-I transmembrane protein consisting of an N-terminal extracellular region that contains four extracellular immunoglobulin-like domains, a transmembrane region, and an intracellular domain with two tyrosine-based motifs (PMID: 9731071). It is expressed on neutrophils, monocytes, dendritic cells, and subsets of tissue macrophages (PMID: 15769739). Siglec-5 binds alpha-2,3-linked, alpha-2,6-linked sialic acid, and is involved in cell adhesion (PMID: 18022638). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4101 Product name: Recombinant human SIGLEC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-442 aa of BC029896 Sequence: IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQSGSVLLLQGRSNLGTGVVPAALG Predict reactive species Full Name: sialic acid binding Ig-like lectin 5 Calculated Molecular Weight: 551 aa, 61 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC029896 Gene Symbol: SIGLEC5 Gene ID (NCBI): 8778 RRID: AB_10643385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15389 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.