Iright
BRAND / VENDOR: Proteintech

Proteintech, 13245-1-AP, CD89 Polyclonal antibody

CATALOG NUMBER: 13245-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD89 (13245-1-AP) by Proteintech is a Polyclonal antibody targeting CD89 in WB, ELISA applications with reactivity to human, pig samples 13245-1-AP targets CD89 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig lung tissue, HL-60 cells, pig spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3928 Product name: Recombinant human FCAR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-227 aa of BC027953 Sequence: QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN Predict reactive species Full Name: Fc fragment of IgA, receptor for Calculated Molecular Weight: 287 aa, 32 kDa Observed Molecular Weight: 55-75 kDa GenBank Accession Number: BC027953 Gene Symbol: CD89 Gene ID (NCBI): 2204 RRID: AB_2293907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24071 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924