Proteintech, 13260-1-AP, MR1 Polyclonal antibody

Size: 20ul / 150ul The MR1 (13260-1-AP) by Proteintech is a Polyclonal antibody targeting MR1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13260-1-AP targets MR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:100-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3849 Product name: Recombinant human MR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-260 aa of BC012485 Sequence: SDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVMKAV Predict reactive species Full Name: major histocompatibility complex, class I-related Calculated Molecular Weight: 341 aa, 39 kDa GenBank Accession Number: BC012485 Gene Symbol: MR1 Gene ID (NCBI): 3140 RRID: AB_2877930 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q95460 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.