Iright
BRAND / VENDOR: Proteintech

Proteintech, 13261-3-AP, DLX3 Polyclonal antibody

CATALOG NUMBER: 13261-3-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DLX3 (13261-3-AP) by Proteintech is a Polyclonal antibody targeting DLX3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13261-3-AP targets DLX3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: JAR cells, mouse lung tissue, NCCIT cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Distal-less homeobox 3 (DLX3), a member of the Dlx family, plays a crucial role in epithelium, hair, bone, tooth and placental development. DLX3 is expressed during the calcium (Ca2+)-dependent epidermal differentiation process. The calculated molecular weight of DLX3 is 32 kDa. This antibody detects the 32-38 kDa protein in SDS-PAGE. (PMID: 31029881) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3865 Product name: Recombinant human DLX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC028970 Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY Predict reactive species Full Name: distal-less homeobox 3 Calculated Molecular Weight: 287 aa, 32 kDa Observed Molecular Weight: 32-38 kDa GenBank Accession Number: BC028970 Gene Symbol: DLX3 Gene ID (NCBI): 1747 RRID: AB_2292996 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60479 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924