Iright
BRAND / VENDOR: Proteintech

Proteintech, 13310-1-AP, ATP2C1 Polyclonal antibody

CATALOG NUMBER: 13310-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP2C1 (13310-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2C1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13310-1-AP targets ATP2C1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, human brain tissue, rat brain tissue, mouse brain tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information ATP2C1, also known as hSPCA1, belongs to the family of P-type cation transport ATPases. ATP2C1 is a Golgi-localized ATPase that mediates Golgi uptake of cytosolic Ca(2+) and Mg(2+) and has a role in regulating Ca(2+) and Mn(2+) cellular content (PMID: 11741891). ATP2C1 is found in most tissues except colon, thymus, spleen, and leukocytes. It is expressed in keratinocytes (PMID: 15831496, 14632183). Defects in ATP2C1 cause Hailey-Hailey disease (HHD)(PMID: 10615129, 28035777). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4143 Product name: Recombinant human ATP2C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 320-654 aa of BC028139 Sequence: LGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKA Predict reactive species Full Name: ATPase, Ca++ transporting, type 2C, member 1 Calculated Molecular Weight: 919 aa, 101 kDa Observed Molecular Weight: 95-103 kDa GenBank Accession Number: BC028139 Gene Symbol: ATP2C1 Gene ID (NCBI): 27032 RRID: AB_10640808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P98194 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924