Proteintech, 13313-1-AP, CXCL7/PPBP Polyclonal antibody

Size: 20ul / 150ul The CXCL7/PPBP (13313-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL7/PPBP in WB, IHC, ELISA applications with reactivity to human, mouse samples 13313-1-AP targets CXCL7/PPBP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, human liver tissue, human plasma tissue Positive IHC detected in: mouse placenta tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4147 Product name: Recombinant human PPBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-128 aa of BC028217 Sequence: TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species Full Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) Calculated Molecular Weight: 128 aa, 14 kDa Observed Molecular Weight: 8-14 kDa GenBank Accession Number: BC028217 Gene Symbol: PPBP Gene ID (NCBI): 5473 RRID: AB_10597238 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.