Iright
BRAND / VENDOR: Proteintech

Proteintech, 13314-1-AP, GMEB2 Polyclonal antibody

CATALOG NUMBER: 13314-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GMEB2 (13314-1-AP) by Proteintech is a Polyclonal antibody targeting GMEB2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13314-1-AP targets GMEB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse ovary tissue, mouse thymus tissue Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GMEB2, also named as Glucocorticoid modulatory element-binding protein 2, is a 530 amino acid protein, which is expressed in peripheral blood lymphocytes and fetal liver. GMEB2 as a trans-acting factor that binds to glucocorticoid modulatory elements (GME) present in the TAT (tyrosine aminotransferase) promoter and increases sensitivity to low concentrations of glucocorticoids. The calcualted molecular weight of GMEB2 is 56 kDa, but modified GMEB2 is about 65-70 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4157 Product name: Recombinant human GMEB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-304 aa of BC036305 Sequence: MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLASHKCQ Predict reactive species Full Name: glucocorticoid modulatory element binding protein 2 Calculated Molecular Weight: 530 aa, 56 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC036305 Gene Symbol: GMEB2 Gene ID (NCBI): 26205 RRID: AB_2110829 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924