Iright
BRAND / VENDOR: Proteintech

Proteintech, 13318-1-AP, CISD2 Polyclonal antibody

CATALOG NUMBER: 13318-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CISD2 (13318-1-AP) by Proteintech is a Polyclonal antibody targeting CISD2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 13318-1-AP targets CISD2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse brain tissue, mouse heart tissue, human brain tissue, rat kidney tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CISD2 gene encodes a 15 kDa CDGSH iron-sulfur domain-containing protein 2, which is also named Miner1 or NAF-1, this protein was reported on the endoplasmic reticulum membrane or mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2), a rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. CISD2 regulates the autophagy program by interacting with BCL2, contributing to antagonizing BECN1-mediated cellular autophagy at the endoplasmic reticulum. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, drosophila Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4172 Product name: Recombinant human CISD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-135 aa of BC032300 Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV Predict reactive species Full Name: CDGSH iron sulfur domain 2 Calculated Molecular Weight: 135 aa, 15 kDa Observed Molecular Weight: 13-15 kDa GenBank Accession Number: BC032300 Gene Symbol: CISD2 Gene ID (NCBI): 493856 RRID: AB_2080270 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5K1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924