Iright
BRAND / VENDOR: Proteintech

Proteintech, 13327-1-AP, VPS54 Polyclonal antibody

CATALOG NUMBER: 13327-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VPS54 (13327-1-AP) by Proteintech is a Polyclonal antibody targeting VPS54 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13327-1-AP targets VPS54 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, mouse pancreas tissue, mouse testis tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information VPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4123 Product name: Recombinant human VPS54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 746-965 aa of BC030275 Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR Predict reactive species Full Name: vacuolar protein sorting 54 homolog (S. cerevisiae) Calculated Molecular Weight: 977 aa, 111 kDa Observed Molecular Weight: 90-93kDa, 111 kDa GenBank Accession Number: BC030275 Gene Symbol: VPS54 Gene ID (NCBI): 51542 RRID: AB_2304414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P1Q0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924