Iright
BRAND / VENDOR: Proteintech

Proteintech, 13335-1-AP, KIR3DL1/CD158E Polyclonal antibody

CATALOG NUMBER: 13335-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIR3DL1/CD158E (13335-1-AP) by Proteintech is a Polyclonal antibody targeting KIR3DL1/CD158E in WB, ELISA applications with reactivity to human samples 13335-1-AP targets KIR3DL1/CD158E in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood leukocytes Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR3DL1 is a receptor on natural killer (NK) cells for HLA Bw4 allele. It inhibits the activity of NK cells thus preventing cell lysis. KIR3DL1 and KIR3DS1 are highly homologous. This antibody is raised against 22-344 amino acids of human KIR3DL1 and recognizes both KIR3DL1 (49 kDa) and KIR3DS1 (43 kDa). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4152 Product name: Recombinant human KIR3DL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-344 aa of BC028206 Sequence: HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIG Predict reactive species Full Name: killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 Calculated Molecular Weight: 444 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC028206 Gene Symbol: KIR3DL1 Gene ID (NCBI): 3811 RRID: AB_2234189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924