Iright
BRAND / VENDOR: Proteintech

Proteintech, 13373-1-AP, LYNX1 Polyclonal antibody

CATALOG NUMBER: 13373-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LYNX1 (13373-1-AP) by Proteintech is a Polyclonal antibody targeting LYNX1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 13373-1-AP targets LYNX1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human oesophagus cancer tissue, mouse brain tissue, human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LYNX1, also named as SLURP2, is a neuronal membrane molecule related to snake a-neurotoxins able to modulate nicotinic acetylcholine receptors (nAChRs). It acts in different tissues through interaction to nAChRs to balance neuronal activity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4195 Product name: Recombinant human LYNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-131 aa of BC032306 Sequence: LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD Predict reactive species Full Name: Ly6/neurotoxin 1 Calculated Molecular Weight: 131 aa, 14 kDa GenBank Accession Number: BC032306 Gene Symbol: LYNX1 Gene ID (NCBI): 66004 RRID: AB_2877944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924