Iright
BRAND / VENDOR: Proteintech

Proteintech, 13374-1-AP, PTGR1 Polyclonal antibody

CATALOG NUMBER: 13374-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTGR1 (13374-1-AP) by Proteintech is a Polyclonal antibody targeting PTGR1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13374-1-AP targets PTGR1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human colon tissue, human liver tissue, mouse liver tissue, HepG2 cells, rar liver tissue Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information PTGR1(Prostaglandin reductase 1) is also named as LTB4DH(NADP-dependent leukotriene B4 12-hydroxydehydrogenase) and belongs to the NADP-dependent oxidoreductase L4BD family. It catalyses the conversion of leukotriene B4 into biologically less reactive 12-oxo-leukotriene B4, a key step for its inactivation and it is a key oxidation step in the process of metabolic inactivation of leukotriene B(4) in various non-leukocyte tissues(PMID:8576264). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4196 Product name: Recombinant human PTGR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC035228 Sequence: MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA Predict reactive species Full Name: prostaglandin reductase 1 Calculated Molecular Weight: 329 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC035228 Gene Symbol: PTGR1 Gene ID (NCBI): 22949 RRID: AB_2173213 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924