Iright
BRAND / VENDOR: Proteintech

Proteintech, 13377-1-AP, Siglec-9 Polyclonal antibody

CATALOG NUMBER: 13377-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Siglec-9 (13377-1-AP) by Proteintech is a Polyclonal antibody targeting Siglec-9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 13377-1-AP targets Siglec-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, U-937 cells, mouse skeletal muscle tissue, A375 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Sialic acid binding Ig-like lectin 9 (Siglec-9), also known as CD329, is a member of the Siglec family of glycan-recognition proteins. Siglec-9 is a type-I transmembrane protein consisting of an N-terminal extracellular region that contains an N-terminal V-set domain and two C2-set domains, a transmembrane region, and an intracellular domain with an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an ITIM-like motif (PMID: 10801862). It is expressed quite broadly among human blood leukocytes, including monocytes, neutrophils, B cells, NK cells, and minor subsets of T cells (PMID: 32322597). Siglec-9 functions as an inhibitory immune checkpoint and can be targeted to enhance therapeutic antitumor immunity (PMID: 34155121; 37460871). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4201 Product name: Recombinant human SIGLEC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-341 aa of BC035365 Sequence: LTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDEAEFTCRAQNPLGSQQVYLNVSLQSKA Predict reactive species Full Name: sialic acid binding Ig-like lectin 9 Calculated Molecular Weight: 463 aa, 50 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC035365 Gene Symbol: Siglec-9 Gene ID (NCBI): 27180 RRID: AB_2187293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924