Proteintech, 13391-1-AP, Galectin-4 Polyclonal antibody

Size: 20ul / 150ul The Galectin-4 (13391-1-AP) by Proteintech is a Polyclonal antibody targeting Galectin-4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13391-1-AP targets Galectin-4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, COLO 320 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-4 contains two arbohydrate recognition domains (CRDs) and is expressed in the epithelium of oral mucosa, esophagus, and intestinal and colonic mucosa (PMID: 15546874; 15115909). Aberrant expression of galectin-4 has been reported in several cancers. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4049 Product name: Recombinant human LGALS4,GAL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC034750 Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI Predict reactive species Full Name: lectin, galactoside-binding, soluble, 4 Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC034750 Gene Symbol: Galectin-4 Gene ID (NCBI): 3960 RRID: AB_2137072 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56470 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.