Iright
BRAND / VENDOR: Proteintech

Proteintech, 13418-1-AP, MED19 Polyclonal antibody

CATALOG NUMBER: 13418-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MED19 (13418-1-AP) by Proteintech is a Polyclonal antibody targeting MED19 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13418-1-AP targets MED19 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Mediator of RNA polymerase II transcription subunit 19 (MED19) is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (PMID: 12584197). Mediator complex is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors (PMID: 15175163). MED19 may be a novel proliferation regulator that promotes lung cancer and gastric cancer progression and cellular growth (PMID: 21519921, PMID: 22565189). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4165 Product name: Recombinant human MED19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC037223 Sequence: MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS Predict reactive species Full Name: mediator complex subunit 19 Calculated Molecular Weight: 194 aa, 20 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC037223 Gene Symbol: MED19 Gene ID (NCBI): 219541 RRID: AB_10644134 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0JLT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924