Iright
BRAND / VENDOR: Proteintech

Proteintech, 13420-1-AP, UGCGL2 Polyclonal antibody

CATALOG NUMBER: 13420-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UGCGL2 (13420-1-AP) by Proteintech is a Polyclonal antibody targeting UGCGL2 in WB, ELISA applications with reactivity to human samples 13420-1-AP targets UGCGL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information UGCGL2 (UDP-glucose glycoprotein glucosyl transferase like 2) attaches a single glucose residue from/to the Man9GlcNAc2 glycan of incompletely folded or misfolded amino acid sequences. UGCGL2 exhibits higher levels in kidney, pancreas, heart, and skeletal muscle. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4189 Product name: Recombinant human UGCGL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-278 aa of BC032302 Sequence: MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS Predict reactive species Full Name: UDP-glucose ceramide glucosyltransferase-like 2 Calculated Molecular Weight: 1516 aa, 168 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC032302 Gene Symbol: UGCGL2 Gene ID (NCBI): 55757 RRID: AB_10644120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYU1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924