Proteintech, 13428-1-AP, POLR2C Polyclonal antibody

Size: 20ul / 150ul The POLR2C (13428-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2C in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13428-1-AP targets POLR2C in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4228 Product name: Recombinant human POLR2C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 58-275 aa of BC028157 Sequence: VLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN Predict reactive species Full Name: polymerase (RNA) II (DNA directed) polypeptide C, 33kDa Calculated Molecular Weight: 275 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC028157 Gene Symbol: POLR2C Gene ID (NCBI): 5432 RRID: AB_2167653 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19387 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.