Iright
BRAND / VENDOR: Proteintech

Proteintech, 13431-1-AP, CYP51A1 Polyclonal antibody

CATALOG NUMBER: 13431-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYP51A1 (13431-1-AP) by Proteintech is a Polyclonal antibody targeting CYP51A1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13431-1-AP targets CYP51A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, rat liver tissue, HuH-7 cells Positive IP detected in: mouse testis tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Lanosterol 14-alpha demethylase (cytochrome P450(51), CYP51A1) belongs to the evolutionarily conserved family of cytochrome P450 and catalyzes one of the key steps in cholesterol biosynthesis. CYP51A1 protein is targeted for degradation when exposed to nitric oxide generated under inflammatory conditions by NOS2 or released from NO donor compounds (PMID: 28830911). CYP51A1 is a prognostic marker in certain cancers, including Cervical squamous cell carcinoma, Head and neck squamous cell carcinoma, Kidney chromophobe, and Kidney renal clear cell carcinoma (PMID: 24711211). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4235 Product name: Recombinant human CYP51A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 146-509 aa of BC032322 Sequence: GKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPVMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK Predict reactive species Full Name: cytochrome P450, family 51, subfamily A, polypeptide 1 Calculated Molecular Weight: 509 aa, 57 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC032322 Gene Symbol: CYP51A1 Gene ID (NCBI): 1595 RRID: AB_2088571 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16850 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924