Iright
BRAND / VENDOR: Proteintech

Proteintech, 13445-1-AP, GIMAP2 Polyclonal antibody

CATALOG NUMBER: 13445-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GIMAP2 (13445-1-AP) by Proteintech is a Polyclonal antibody targeting GIMAP2 in WB, IHC, ELISA applications with reactivity to human samples 13445-1-AP targets GIMAP2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue, human kidney tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information This protein was not eliminated clearly. It belongs to GTPase of the immunity-associated protein family. One of its homologous protein, GIMAP1, runs as a 30kd protein in SDS-PAGE, lower than the calculated molecular weight. This antibody detected one 28kd band in several tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4273 Product name: Recombinant human GIMAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC032345 Sequence: MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAE Predict reactive species Full Name: GTPase, IMAP family member 2 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 28-40 kDa GenBank Accession Number: BC032345 Gene Symbol: GIMAP2 Gene ID (NCBI): 26157 RRID: AB_2111871 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UG22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924