Proteintech, 13461-2-AP, BPIL1 Polyclonal antibody

Size: 20ul / 150ul The BPIL1 (13461-2-AP) by Proteintech is a Polyclonal antibody targeting BPIL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13461-2-AP targets BPIL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Bactericidal/permeability-increasing protein-like 1 (BPIL1, also known as LPLUNC2 or BPIFB2) is a member of the lipid transfer (LT)/lipopolysaccharide binding protein (LBP) family. LT/LBP proteins are structurally related proteins capable of binding phospholipids and lipopolysaccharides (PMID: 12185532). The gene of BPIL1 maps to Chromosome 20q11, and encodes a 458-amino acid protein with a calculated molecular weight of 49 kDa. It is highly expressed in hypertrophic tonsils. BPIL1 has been identified as a nasal mucous protein that may be involved in immune response in the nose against microbial infections (PMID: 15996010). Reduced expression of antimicrobial PLUNC proteins (LPLUNC1 and LPLUNC2) has been reported in nasal polyp tissues of patients with chronic rhinosinusitis (PMID: 22676062). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4051 Product name: Recombinant human BPIL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-424 aa of BC034415 Sequence: IILPTDATPFVLPRHVGTEGSMATGGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKLQGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAM Predict reactive species Full Name: bactericidal/permeability-increasing protein-like 1 Calculated Molecular Weight: 458 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC034415 Gene Symbol: BPIL1 Gene ID (NCBI): 80341 RRID: AB_2067089 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.