Iright
BRAND / VENDOR: Proteintech

Proteintech, 13479-1-AP, SENP8 Polyclonal antibody

CATALOG NUMBER: 13479-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SENP8 (13479-1-AP) by Proteintech is a Polyclonal antibody targeting SENP8 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13479-1-AP targets SENP8 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat kidney tissue, human liver tissue, human colon cancer tissue, human kidney tissue, human stomach cancer tissue, mouse pancreas tissue, rat pancreas tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SENP8, a human NEDD8-specific protease, also known as NEDP1. It is expected to be located in cytoplasm and nucleus, which is highly expressed in kidney and pancreas. The calculated molecular weight of SENP8 is 24 kDa. It is a protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53 (PMID: 15242646). A single-residue difference in the C-terminus of NEDD8 and ubiquitin contributes significantly to the ability of NEDP1 to discriminate between them. In vivo analysis indicates that NEDP1 mutants perturb deNEDDylation of the tumour suppressor p53 (PMID: 12759363). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4287 Product name: Recombinant human SENP8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-212 aa of BC031411 Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK Predict reactive species Full Name: SUMO/sentrin specific peptidase family member 8 Calculated Molecular Weight: 212 aa, 24 kDa Observed Molecular Weight: 24-28 kDa GenBank Accession Number: BC031411 Gene Symbol: SENP8 Gene ID (NCBI): 123228 RRID: AB_3085415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LD8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924