Iright
BRAND / VENDOR: Proteintech

Proteintech, 13489-1-AP, NLGN4Y Polyclonal antibody

CATALOG NUMBER: 13489-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NLGN4Y (13489-1-AP) by Proteintech is a Polyclonal antibody targeting NLGN4Y in WB, ELISA applications with reactivity to human samples 13489-1-AP targets NLGN4Y in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, PC-3 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NLGN4Y, one member of Neuroligins, is cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses , NLGN4Y was expressed in fetal and adult brain, prostate, testis, pancreas. NLGN4Y is homologous with its X-linked homolog, NLGN4X. The antibody can recognize both of NLGN4Y and NLGN4X at 72kDa mature form. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4311 Product name: Recombinant human NLGN4Y protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC032567 Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEAR Predict reactive species Full Name: neuroligin 4, Y-linked Calculated Molecular Weight: 816 aa, 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC032567 Gene Symbol: NLGN4Y Gene ID (NCBI): 22829 RRID: AB_2235981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924