Iright
BRAND / VENDOR: Proteintech

Proteintech, 13492-1-AP, SNX16 Polyclonal antibody

CATALOG NUMBER: 13492-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNX16 (13492-1-AP) by Proteintech is a Polyclonal antibody targeting SNX16 in WB, IF/ICC, ELISA applications with reactivity to human samples 13492-1-AP targets SNX16 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells, U-251 cells Positive IF/ICC detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SNX16,Sorting nexin 16, is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which mediates membrane association by interaction with phosphoinositides. SNX16 associates with late endosome membranes as is involved in tubule formation, cholesterol transport, and transport of tetraspanin CD81. It also inhibits cell migration and tumorigenesis. SNX16 directs the sorting of EGFR to the endosomal compartment and thus regulates EGF-induced cell signaling (PMID:15292396). It may function in the trafficking of proteins between the early and late endosomal compartments. SNX16 was detected 49-53 kDa in human (PMID:12813048). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4315 Product name: Recombinant human SNX16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC033630 Sequence: MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED Predict reactive species Full Name: sorting nexin 16 Calculated Molecular Weight: 344 aa, 39 kDa Observed Molecular Weight: 39-50 kDa GenBank Accession Number: BC033630 Gene Symbol: SNX16 Gene ID (NCBI): 64089 RRID: AB_3085416 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924