Proteintech, 13500-1-AP, RIAM Polyclonal antibody

Size: 20ul / 150ul The RIAM (13500-1-AP) by Proteintech is a Polyclonal antibody targeting RIAM in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 13500-1-AP targets RIAM in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information APBB1IP gene encodes a Rap1-GTP-interacting adapter molecule (RIAM) which is an important protein in Rap1-mediated integrin activation and adhesion. Rap1 is a small GTPase frequently activated in tumors such as melanoma and prostate cancer. RIAM is widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes. RIAM may function in the signal transduction from Ras activation to actin cytoskeletal remodeling. The observed molecular weight of RIAM is about 100 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4327 Product name: Recombinant human RIAM,APBB1IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC035636 Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP Predict reactive species Full Name: amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein Calculated Molecular Weight: 666 aa, 73 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC035636 Gene Symbol: RIAM Gene ID (NCBI): 54518 RRID: AB_2057231 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z5R6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.