Iright
BRAND / VENDOR: Proteintech

Proteintech, 13506-1-AP, TAF7 Polyclonal antibody

CATALOG NUMBER: 13506-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAF7 (13506-1-AP) by Proteintech is a Polyclonal antibody targeting TAF7 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13506-1-AP targets TAF7 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, MCF-7 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TAF7, also named as Transcription initiation factor TFIID 55 kDa subunit, is a 349 amino acid protein, which belongs to the TAF7 family. TAF7 functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF7 is phosphorylated by CIITA. The calcualted molecular weight of TAF7 is 40 kDa, but phosphorylated TAF7 is about 55kDa. (PMID: 22711989) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4406 Product name: Recombinant human TAF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC032737 Sequence: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK Predict reactive species Full Name: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa Calculated Molecular Weight: 349 aa, 40 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC032737 Gene Symbol: TAF7 Gene ID (NCBI): 6879 RRID: AB_2271400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15545 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924